Talk:Enaptin

A fact from Enaptin appeared on Wikipedia's Main Page in the Did you know column on 30 March 2005. The text of the entry was as follows:

Did you know... that enaptin has the second-longest chemical name to be written down, at 64,060 letters?

A record of the entry may be seen at Wikipedia:Recent additions/2005/March.

Wikipedia

Molecular Biology: MCB

	This article is within the scope of WikiProject Molecular Biology, a collaborative effort to improve the coverage of Molecular Biology on Wikipedia. If you would like to participate, please visit the project page, where you can join the discussion and see a list of open tasks.Molecular BiologyWikipedia:WikiProject Molecular BiologyTemplate:WikiProject Molecular BiologyMolecular Biology articles
???	This article has not yet received a rating on the importance scale.
	This article is supported by the Molecular and Cell Biology task force (assessed as Low-importance).

Untitled

wow

Could anyone explain why the word is so long?

It is not a word per se, but rather a chemical code, as with other similiar substances.

- For an explanation of how the word is made, see Acetylseryltyrosylserylisol...serine#Etymology. -- BRIAN0918 01:47, 30 Mar 2005 (UTC)

Look at the crap!

What was with all this:

MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKL- PCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSS- SASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELV- DLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP- GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRD-

(times eight)

? --User:Alex12_3

Are you an idiot? Did you even try reading the article? -- BRIAN0918 03:22, 30 Mar 2005 (UTC)
Yeah, I didn't understand it either at first...... then I read the article --Headcase 05:09, 30 Mar 2005 (UTC)

Not the longest

It's been brought to my attention that the largest protein in the body is called titin (appropriately), and has 27,000 amino acids. Expect an article soon. -- BRIAN0918 05:28, 30 Mar 2005 (UTC)

Alright, it's official: 189,819 letters. -- BRIAN0918 05:43, 30 Mar 2005 (UTC)

Article be cleaned up please

Article be cleaned up please sec fan 08:31, Mar 30, 2005 (UTC)

Removing that long word...

I suggest it be removed... and/or just linked to (or create a new page with this word), as it seems inappropriate in this main article, and people keep removing it not knowing why it was there in the first place. sec fan 11:08, Mar 30, 2005 (UTC)

In contrast to Titin, there are little web pages containing the full chemical name of Enaptin. Therefore, I would like to ask everybody for giving reliable web pages about it, except the following web pages:

I provide the preceding web pages for somebody who has curiosity. QQ (talk) 20:34, 17 February 2008 (UTC)[reply]

Thanks for the vandalism

Thanks for completely vandalizing and tearing to shreds my article overnight. Did any of you even bother to correct the vandalism in the page? No. You were too busy deleting all of its contents to notice the vandalism. -- BRIAN0918 12:58, 30 Mar 2005 (UTC)

How pitiful...

Just because the f***ing molecule's name is so long you are having a fight? Come to your senses! --Belgrader 17:59, 30 Mar 2005 (UTC)

Wiki Education assignment: Biochemistry II

This article was the subject of a Wiki Education Foundation-supported course assignment, between 16 January 2024 and 1 May 2024. Further details are available on the course page. Student editor(s): Mr.Sanguine (article contribs).

— Assignment last updated by Mr.Sanguine (talk) 13:56, 25 March 2024 (UTC)[reply]